| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRM1. This antibody reacts with human. The TRM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP |
| Other Names | EC 2.1.1.32, FLJ20244, N(2)-N(2)-dimethylguanosine tRNA methyltransferase, TRM1, TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae), tRNA 2,2-dimethylguanosine-26 methyltransferase, tRNA(guanine-26, N(2)-N(2)) methyltransferase, tRNA(m(2,2)G26)dimethyltransferase |
| Gene, Accession # | TRMT1, Gene ID: 55621, Accession: Q9NXH9 |
| Catalog # | NBP1-82197 |
| Price | |
| Order / More Info | TRM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|