| 产品详情 |
| Edit |   |
| Antigenic Specificity | TrkC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TrkC Antibody from Novus Biologicals is a rabbit polyclonal antibody to TrkC. This antibody reacts with human. The TrkC Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TrkC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI |
| Other Names | EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C |
| Gene, Accession # | NTRK3, Gene ID: 4916 |
| Catalog # | NBP2-55927 |
| Price | |
| Order / More Info | TrkC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|