| Edit |   |
|---|
| Antigenic Specificity | STAC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STAC Antibody from Novus Biologicals is a rabbit polyclonal antibody to STAC. This antibody reacts with human. The STAC Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human STAC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY |
|---|
| Other Names | FLJ32331, SH3 and cysteine rich domain, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein, src homology three (SH3) and cysteine rich domain, STAC1 |
|---|
| Gene, Accession # | STAC, Gene ID: 6769, Accession: Q99469 |
|---|
| Catalog # | NBP1-80717 |
|---|
| Price | |
|---|
| Order / More Info | STAC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|