| Edit |   |
|---|
| Antigenic Specificity | ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process. |
|---|
| Immunogen | CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV |
|---|
| Other Names | AL118244|Skd3|HSP78|SKD3 |
|---|
| Gene, Accession # | Gene ID: 81570 |
|---|
| Catalog # | ABIN632528 |
|---|
| Price | |
|---|
| Order / More Info | ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|