| Edit |   |
|---|
| Antigenic Specificity | ST5 |
|---|
| Clone | 1A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST5 Antibody (1A3) from Novus Biologicals is a mouse monoclonal antibody to ST5. This antibody reacts with human. The ST5 Antibody (1A3) has been validated for the following applications: ELISA. |
|---|
| Immunogen | ST5 (NP_005409 1038 a.a. - 1135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK |
|---|
| Other Names | DENN domain-containing protein 2B, DENND2BDENN/MADD domain containing 2B, HeLa tumor suppression 1, HTS1MGC33090, p126, suppression of tumorigenicity 5, suppression of tumorigenicity 5 protein |
|---|
| Gene, Accession # | ST5, Gene ID: 6764, Accession: NP_005409, SwissProt: NP_005409 |
|---|
| Catalog # | H00006764-M01 |
|---|
| Price | |
|---|
| Order / More Info | ST5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|