| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Otubain-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Otubain-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Otubain-1. This antibody reacts with human, mouse, rat. The Otubain-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat Otubain-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD |
|---|
| Other Names | Deubiquitinating enzyme OTUB1, EC 3.1.2, EC 3.4.19.12, FLJ20113, FLJ40710, hOTU1, MGC111158, OTB1MGC4584, OTU domain, ubiquitin aldehyde binding 1, OTU domain-containing ubiquitin aldehyde-binding protein 1, OTU1OTU-domain Ubal-binding 1, otubain-1, ubiquitin thioesterase OTUB1, ubiquitin-specific protease otubain 1, Ubiquitin-specific-processing protease OTUB1 |
|---|
| Gene, Accession # | OTUB1, Gene ID: 55611 |
|---|
| Catalog # | NBP1-83670 |
|---|
| Price | |
|---|
| Order / More Info | Otubain-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|