| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NGFI-B alpha/Nur77/NR4A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NGFI-B alpha/Nur77/NR4A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NGFI-B alpha/Nur77/NR4A1. This antibody reacts with human. The NGFI-B alpha/Nur77/NR4A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS |
|---|
| Other Names | Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor |
|---|
| Gene, Accession # | NR4A1, Gene ID: 3164 |
|---|
| Catalog # | NBP2-68896 |
|---|
| Price | |
|---|
| Order / More Info | NGFI-B alpha/Nur77/NR4A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|