| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | THADA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The THADA Antibody from Novus Biologicals is a rabbit polyclonal antibody to THADA. This antibody reacts with human. The THADA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human THADA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MLCQLLPMQPVPESSDGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATR |
|---|
| Other Names | death receptor-interacting protein, FLJ21877, FLJ44016, FLJ44876, gene inducing thyroid adenomas protein, KIAA1767, thyroid adenoma associated, thyroid adenoma-associated protein |
|---|
| Gene, Accession # | THADA, Gene ID: 63892, Accession: Q6YHU6, SwissProt: Q6YHU6 |
|---|
| Catalog # | NBP2-38239 |
|---|
| Price | |
|---|
| Order / More Info | THADA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|