| Edit |   |
| Antigenic Specificity | RPS27L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPS27L Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS27L. This antibody reacts with human. The RPS27L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RPS27L(ribosomal protein S27-like) The peptide sequence was selected from the N terminal of RPS27L. Peptide sequence MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA. |
| Other Names | 40S ribosomal protein S27-like, ribosomal protein S27-like |
| Gene, Accession # | RPS27L, Gene ID: 51065 |
| Catalog # | NBP1-56857 |
| Price | |
| Order / More Info | RPS27L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |