| 产品详情 |
| Edit |   |
| Antigenic Specificity | RPS19BP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPS19BP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS19BP1. This antibody reacts with human. The RPS19BP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RPS19BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS |
| Other Names | 40S ribosomal protein S19-binding protein 1, AROS, dJ1104E15.4, FLJ21770, homolog of mouse S19 binding protein, MGC52010RPS19-binding protein 1, ribosomal protein S19 binding protein 1, S19BPactive regulator of SIRT1 |
| Gene, Accession # | RPS19BP1, Gene ID: 91582 |
| Catalog # | NBP1-83617 |
| Price | |
| Order / More Info | RPS19BP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|