| 产品详情 |
| Edit |   |
| Antigenic Specificity | RPSA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPSA Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPSA. This antibody reacts with human. The RPSA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to RPSA(ribosomal protein SA) The peptide sequence was selected from the middle region of RPSA (NP_002286). Peptide sequence TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY. |
| Other Names | 37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 37LRPNEM/1CHD4, 67 kDa laminin receptor, 67kD, ribosomal protein SA, 67LR, Colon carcinoma laminin-binding protein, LAMBR37 kDa laminin receptor, laminin binding protein, Laminin receptor 1, laminin receptor 1 (67kD, ribosomal protein SA), Laminin-binding protein precursor p40, lamR, LAMR 1, LAMR140S ribosomal protein SA, LBP, LBP/p40, LRP, LRP/LR, Multidrug resistance-associated protein MGr1-Ag, p40, ribosomal protein SA |
| Gene, Accession # | RPSA, Gene ID: 3921, Accession: P08865, SwissProt: P08865 |
| Catalog # | NBP1-59114 |
| Price | |
| Order / More Info | RPSA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|