| Edit |   |
| Antigenic Specificity | RPS9 |
| Clone | 2D3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | ELISA. It has been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPS9 Antibody (2D3) from Novus Biologicals is a mouse monoclonal antibody to RPS9. This antibody reacts with human. The RPS9 Antibody (2D3) has been validated for the following applications: ELISA. |
| Immunogen | RPS9 (AAH00802.1, 82 a.a. - 171 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPG |
| Other Names | ribosomal protein S9,40S ribosomal protein S9 |
| Gene, Accession # | RPS9, Gene ID: 6203, Accession: AAH00802, SwissProt: AAH00802 |
| Catalog # | H00006203-M03 |
| Price | |
| Order / More Info | RPS9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |