| Edit |   |
|---|
| Antigenic Specificity | RPS8 |
|---|
| Clone | 4D11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS8 Antibody (4D11) from Novus Biologicals is a mouse monoclonal antibody to RPS8. This antibody reacts with human. The RPS8 Antibody (4D11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RPS8 (NP_001003.1, 109 a.a. - 207 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKG |
|---|
| Other Names | OK/SW-cl.83, ribosomal protein S8,40S ribosomal protein S8 |
|---|
| Gene, Accession # | RPS8, Gene ID: 6202, Accession: NP_001003, SwissProt: NP_001003 |
|---|
| Catalog # | H00006202-M02 |
|---|
| Price | |
|---|
| Order / More Info | RPS8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|