| Edit |   |
|---|
| Antigenic Specificity | RPS7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS7. This antibody reacts with human. The RPS7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPS7(ribosomal protein S7) The peptide sequence was selected from the N terminal of RPS7. Peptide sequence MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE. |
|---|
| Other Names | DBA8,40S ribosomal protein S7, ribosomal protein S7 |
|---|
| Gene, Accession # | RPS7, Gene ID: 6201, Accession: P62081, SwissProt: P62081 |
|---|
| Catalog # | NBP1-57394 |
|---|
| Price | |
|---|
| Order / More Info | RPS7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|