| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MSH6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MSH6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MSH6. This antibody reacts with human, mouse, rat. The MSH6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat MSH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV |
|---|
| Other Names | DNA mismatch repair protein Msh6, G/T mismatch-binding protein, GTBPHNPCC5, GTMBP, hMSH6, HSAP, mutS (E. coli) homolog 6, mutS homolog 6 (E. coli), MutS-alpha 160 kDa subunit, p160, sperm-associated protein |
|---|
| Gene, Accession # | MSH6, Gene ID: 2956 |
|---|
| Catalog # | NBP1-83319 |
|---|
| Price | |
|---|
| Order / More Info | MSH6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|