| Edit |   |
|---|
| Antigenic Specificity | MSH4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MSH4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MSH4. This antibody reacts with human. The MSH4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MSH4(mutS homolog 4 (E. coli)) The peptide sequence was selected from the N terminal of MSH4. Peptide sequence SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV. |
|---|
| Other Names | hMSH4, mutS (E. coli) homolog 4, mutS homolog 4 (E. coli), mutS protein homolog 4 |
|---|
| Gene, Accession # | MSH4, Gene ID: 4438, Accession: O15457, SwissProt: O15457 |
|---|
| Catalog # | NBP1-58170 |
|---|
| Price | |
|---|
| Order / More Info | MSH4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|