| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MS4A8B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P, WB reported in scientific literature (PMID: 24789009). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MS4A8B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MS4A8B. This antibody reacts with human. The MS4A8B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MS4A8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK |
|---|
| Other Names | 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4 |
|---|
| Gene, Accession # | MS4A8B, Gene ID: 83661, Accession: Q9BY19, SwissProt: Q9BY19 |
|---|
| Catalog # | NBP1-81026 |
|---|
| Price | |
|---|
| Order / More Info | MS4A8B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24789009 |
|---|
| 产品资料 |
|
|