| 产品详情 |
| Edit |   |
| Antigenic Specificity | MS4A6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MS4A6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to MS4A6A. This antibody reacts with human. The MS4A6A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MS4A6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV |
| Other Names | 4SPAN3, CD20 antigen-like 3, CD20L3MS4A6A-polymorph, CD20-like precusor, Four-span transmembrane protein 3, four-span transmembrane protein 3.1,4SPAN3.2, four-span transmembrane protein 3.2, HAIRB-iso, membrane-spanning 4-domains subfamily A member 6A, membrane-spanning 4-domains, subfamily A, member 6A, MGC131944, MGC22650, MS4A6MST090, MSTP090 |
| Gene, Accession # | MS4A6A, Gene ID: 64231 |
| Catalog # | NBP1-86541 |
| Price | |
| Order / More Info | MS4A6A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|