| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MS4A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF reported in (PMID: 25886616). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MS4A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MS4A3. This antibody reacts with human. The MS4A3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MS4A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK |
|---|
| Other Names | CD20 antigen homolog, CD20 antigen-like protein, CD20LIgE receptor beta subunit, hematopoietic cell 4 transmembrane protein, Hematopoietic-specific transmembrane protein 4, HTm4, HTM4IgE receptor beta chain, membrane-spanning 4-domains subfamily A member 3, membrane-spanning 4-domains, subfamily A, member 3 (hematopoieticcell-specific) |
|---|
| Gene, Accession # | MS4A3, Gene ID: 932 |
|---|
| Catalog # | NBP1-86543 |
|---|
| Price | |
|---|
| Order / More Info | MS4A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25886616 |
|---|
| 产品资料 |
|
|