| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELAVL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: bovine, monkey, rabbit) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | ELAV-like protein 4;Hu-antigen D;HuD;Paraneoplastic encephalomyelitis antigen HuD;ELAVL4;HUD, PNEM; |
|---|
| Gene, Accession # | ELAVL4, UniProt: P26378 |
|---|
| Catalog # | PB9698 |
|---|
| Price | |
|---|
| Order / More Info | ELAVL4 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|