| 产品详情 |
| Edit |   |
| Antigenic Specificity | CBR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBR1. This antibody reacts with human, mouse, rat. The CBR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
| Other Names | 15-hydroxyprostaglandin dehydrogenase [NADP+], carbonyl reductase (NADPH) 1, carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase, carbonyl reductase [NADPH] 1, carbonyl reductase 1, CBR, CRN, EC 1.1.1.184, EC 1.1.1.189, hCBR1, NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductase, Prostaglandin-E(2) 9-reductase, SDR21C1, short chain dehydrogenase/reductase family 21C, member 1 |
| Gene, Accession # | CBR1, Gene ID: 873, Accession: P16152, SwissProt: P16152 |
| Catalog # | NBP1-86595 |
| Price | |
| Order / More Info | CBR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|