| 产品详情 |
| Edit |   |
| Antigenic Specificity | CBLL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CBLL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBLL1. This antibody reacts with human. The CBLL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CBLL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP |
| Other Names | Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Casitas B-lineage lymphoma-transforming sequence-like protein 1, c-Cbl-like protein 1, E3 ubiquitin-protein ligase Hakai, EC 6.3.2, EC 6.3.2.-, E-cadherin binding protein E7, HAKAIRNF188FLJ23109, MGC163401, MGC163403, RING finger protein 188 |
| Gene, Accession # | CBLL1, Gene ID: 79872 |
| Catalog # | NBP1-83589 |
| Price | |
| Order / More Info | CBLL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|