| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLR3GL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLR3GL Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR3GL. This antibody reacts with human. The POLR3GL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human POLR3GL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD |
|---|
| Other Names | alternative RNA polymerase III subunit 32, DNA-directed RNA polymerase III subunit G-like, DNA-directed RNA polymerase III subunit RPC7-like, flj32422, FLJ34890, MGC3200, polymerase (RNA) III (DNA directed) polypeptide G (32kD) like, polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like, RNA polymerase III subunit C7-like, RPC32HOM, RPC32-like protein |
|---|
| Gene, Accession # | POLR3GL, Gene ID: 84265, Accession: Q9BT43, SwissProt: Q9BT43 |
|---|
| Catalog # | NBP1-81997 |
|---|
| Price | |
|---|
| Order / More Info | POLR3GL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|