| Edit |   |
|---|
| Antigenic Specificity | POLR3G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLR3G Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR3G. This antibody reacts with human. The POLR3G Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human POLR3G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWR |
|---|
| Other Names | DNA-directed RNA polymerase III 32 kDa polypeptide, DNA-directed RNA polymerase III subunit G, DNA-directed RNA polymerase III subunit RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD), RNA polymerase III 32 kDa subunit, RNA polymerase III subunit C7, RPC32RPC7 |
|---|
| Gene, Accession # | POLR3G, Gene ID: 10622 |
|---|
| Catalog # | NBP2-55778 |
|---|
| Price | |
|---|
| Order / More Info | POLR3G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|