| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLR3F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLR3F Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR3F. This antibody reacts with human. The POLR3F Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to POLR3F(polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa) The peptide sequence was selected from the middle region of POLR3F. Peptide sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE. |
|---|
| Other Names | DNA-directed RNA polymerase III 39 kDa polypeptide, DNA-directed RNA polymerase III subunit F, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerases III 39 kDa polypeptide, polymerase (RNA) III (DNA directed) polypeptide F (39 kDa), polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, RNA polymerase III 39 kDa subunit, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, RPC39MGC13517, RPC6 |
|---|
| Gene, Accession # | POLR3F, Gene ID: 10621, Accession: Q9H1D9, SwissProt: Q9H1D9 |
|---|
| Catalog # | NBP1-52916-20ul |
|---|
| Price | |
|---|
| Order / More Info | POLR3F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|