| 产品详情 |
| Edit |   |
| Antigenic Specificity | POLR3F |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POLR3F Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR3F. This antibody reacts with human. The POLR3F Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human POLR3F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGGEISPSNCI |
| Other Names | DNA-directed RNA polymerase III 39 kDa polypeptide, DNA-directed RNA polymerase III subunit F, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerases III 39 kDa polypeptide, polymerase (RNA) III (DNA directed) polypeptide F (39 kDa), polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, RNA polymerase III 39 kDa subunit, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, RPC39MGC13517, RPC6 |
| Gene, Accession # | POLR3F, Gene ID: 10621 |
| Catalog # | NBP2-47328 |
| Price | |
| Order / More Info | POLR3F Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|