| 产品详情 |
| Edit |   |
| Antigenic Specificity | POLR3E |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POLR3E Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR3E. This antibody reacts with human, mouse, rat. The POLR3E Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human POLR3E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ |
| Other Names | DNA-directed RNA polymerase III 80 kDa polypeptide, DNA-directed RNA polymerase III subunit RPC5, FLJ10509, KIAA1452, polymerase (RNA) III (DNA directed) polypeptide E (80kD), RNA polymerase III 80 kDa subunit RPC5, RNA polymerase III subunit C5, RPC5, SIN |
| Gene, Accession # | POLR3E, Gene ID: 55718 |
| Catalog # | NBP1-84621 |
| Price | |
| Order / More Info | POLR3E Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|