| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCL11/I-TAC |
|---|
| Clone | 3D9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL11/I-TAC Antibody (3D9) from Novus Biologicals is a mouse monoclonal antibody to CXCL11/I-TAC. This antibody reacts with human. The CXCL11/I-TAC Antibody (3D9) has been validated for the following applications: ELISA. |
|---|
| Immunogen | CXCL11 (AAH05292, 1 a.a. - 94 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
|---|
| Other Names | Beta-R1, b-R1, chemokine (C-X-C motif) ligand 11, H174IP9, Interferon gamma-inducible protein 9, Interferon-inducible T-cell alpha chemoattractant, IP-9member 11, ITAC, I-TACMGC102770, small inducible cytokine subfamily B (Cys-X-Cys), member 9B, Small-inducible cytokine B11 |
|---|
| Gene, Accession # | CXCL11, Gene ID: 6373, Accession: AAH05292, SwissProt: AAH05292 |
|---|
| Catalog # | H00006373-M10 |
|---|
| Price | |
|---|
| Order / More Info | CXCL11/I-TAC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|