| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PEPP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PEPP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PEPP2. This antibody reacts with human. The PEPP2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PEPP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSVKLNSLPSEYESGSACPAQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKIQKGRGHEEETRGVI |
|---|
| Other Names | FLJ10667, FLJ26734, KIAA1686FLJ31492, PEPP-2, PEPP2phosphoinositol 3-phosphate-binding protein-2, PH domain-containing family A member 5, Phosphoinositol 3-phosphate-binding protein 2, pleckstrin homology domain containing, family A member 5, pleckstrin homology domain-containing family A member 5 |
|---|
| Gene, Accession # | PLEKHA5, Gene ID: 54477 |
|---|
| Catalog # | NBP2-58961 |
|---|
| Price | |
|---|
| Order / More Info | PEPP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|