| 产品详情 |
| Edit |   |
| Antigenic Specificity | Perilipin-3/TIP47 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Perilipin-3/TIP47 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Perilipin-3/TIP47. This antibody reacts with human. The Perilipin-3/TIP47 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Perilipin-3/TIP47 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ |
| Other Names | Cargo selection protein TIP47, M6PRBP1MGC2012, Mannose-6-phosphate receptor-binding protein 1, perilipin 3,47 kDa MPR-binding protein, perilipin-3, Placental protein 17,47 kDa mannose 6-phosphate receptor-binding protein, PP17MGC11117, tail-interacting protein, 47 kD, TIP47mannose-6-phosphate receptor binding protein 1 |
| Gene, Accession # | PLIN3, Gene ID: 10226 |
| Catalog # | NBP2-49485 |
| Price | |
| Order / More Info | Perilipin-3/TIP47 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|