| Edit |   |
| Antigenic Specificity | Coagulation Factor XI |
| Clone | 3C7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | ELISA. It has been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Coagulation Factor XI Antibody (3C7) from Novus Biologicals is a mouse monoclonal antibody to Coagulation Factor XI. This antibody reacts with human. The Coagulation Factor XI Antibody (3C7) has been validated for the following applications: ELISA. |
| Immunogen | F11 (NP_000119 286 a.a. - 385 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK |
| Other Names | coagulation factor XI, EC 3.4.21, EC 3.4.21.27, FXIPlasma thromboplastin antecedent, MGC141891, PTA |
| Gene, Accession # | F11, Gene ID: 2160, Accession: NP_000119, SwissProt: NP_000119 |
| Catalog # | H00002160-M02 |
| Price | |
| Order / More Info | Coagulation Factor XI Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |