| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Coagulation Factor XI |
|---|
| Clone | 2H8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Coagulation Factor XI Antibody (2H8) from Novus Biologicals is a mouse monoclonal antibody to Coagulation Factor XI. This antibody reacts with human. The Coagulation Factor XI Antibody (2H8) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | F11 (NP_000119 286 a.a. - 385 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK |
|---|
| Other Names | coagulation factor XI, EC 3.4.21, EC 3.4.21.27, FXIPlasma thromboplastin antecedent, MGC141891, PTA |
|---|
| Gene, Accession # | F11, Gene ID: 2160, Accession: NP_000119, SwissProt: NP_000119 |
|---|
| Catalog # | H00002160-M01 |
|---|
| Price | |
|---|
| Order / More Info | Coagulation Factor XI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|