| Edit |   |
| Antigenic Specificity | Ift80 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ift80 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ift80. This antibody reacts with mouse. The Ift80 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. |
| Other Names | ATD2, intraflagellar transport 80 homolog (Chlamydomonas), intraflagellar transport protein 80 homolog, KIAA1374WDR56WD repeat domain 56, MGC126543, WD repeat-containing protein 56 |
| Gene, Accession # | IFT80, Gene ID: 57560, Accession: Q8K057 |
| Catalog # | NBP1-74179 |
| Price | |
| Order / More Info | Ift80 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |