| Edit |   |
|---|
| Antigenic Specificity | Ift80 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ift80 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ift80. This antibody reacts with mouse. The Ift80 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. |
|---|
| Other Names | ATD2, intraflagellar transport 80 homolog (Chlamydomonas), intraflagellar transport protein 80 homolog, KIAA1374WDR56WD repeat domain 56, MGC126543, WD repeat-containing protein 56 |
|---|
| Gene, Accession # | IFT80, Gene ID: 57560, Accession: Q8K057 |
|---|
| Catalog # | NBP1-74179-20ul |
|---|
| Price | |
|---|
| Order / More Info | Ift80 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|