| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IFT52 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFT52 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFT52. This antibody reacts with human. The IFT52 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IFT52 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA |
|---|
| Other Names | CGI-53, chromosome 20 open reading frame 9, dJ1028D15.1, intraflagellar transport 52 homolog (Chlamydomonas), intraflagellar transport protein 52 homolog, NGD2, NGD5C20orf9, Protein NGD5 homolog |
|---|
| Gene, Accession # | IFT52, Gene ID: 51098 |
|---|
| Catalog # | NBP2-55756 |
|---|
| Price | |
|---|
| Order / More Info | IFT52 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|