| Edit |   |
| Antigenic Specificity | PLAC1L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PLAC1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLAC1L. This antibody reacts with human. The PLAC1L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PLAC1L(placenta-specific 1-like) The peptide sequence was selected from the middle region of PLAC1L. Peptide sequence YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW. |
| Other Names | FLJ36198, placenta-specific 1-like, placenta-specific 1-like protein, TMEM122, transmembrane protein 122 |
| Gene, Accession # | PLAC1L, Gene ID: 219990, Accession: Q86WS3, SwissProt: Q86WS3 |
| Catalog # | NBP1-57983 |
| Price | |
| Order / More Info | PLAC1L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |