| Edit |   |
|---|
| Antigenic Specificity | PLAC1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLAC1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLAC1L. This antibody reacts with human. The PLAC1L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLAC1L(placenta-specific 1-like) The peptide sequence was selected from the middle region of PLAC1L. Peptide sequence YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW. |
|---|
| Other Names | FLJ36198, placenta-specific 1-like, placenta-specific 1-like protein, TMEM122, transmembrane protein 122 |
|---|
| Gene, Accession # | PLAC1L, Gene ID: 219990, Accession: Q86WS3, SwissProt: Q86WS3 |
|---|
| Catalog # | NBP1-57983-20ul |
|---|
| Price | |
|---|
| Order / More Info | PLAC1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|