| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Placental Lactogen/CSH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Placental Lactogen/CSH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Placental Lactogen/CSH1. This antibody reacts with human. The Placental Lactogen/CSH1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to CSH1 (chorionic somatomammotropin hormone 1 (placental lactogen)) The peptide sequence was selected from the middle region of CSH1. Peptide sequence SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS. |
|---|
| Other Names | Choriomammotropin, chorionic somatomammotropin hormone, chorionic somatomammotropin hormone 1 (placental lactogen), CS-1, CSAchorionic somatomammotropin A, CSH2, CSMT, FLJ75407, hCS-A, Lactogen, Placental lactogen, PLchoriomammotropin |
|---|
| Gene, Accession # | CSH1, Gene ID: 1442, Accession: P01243, SwissProt: P01243 |
|---|
| Catalog # | NBP1-59302 |
|---|
| Price | |
|---|
| Order / More Info | Placental Lactogen/CSH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|