| Edit |   |
|---|
| Antigenic Specificity | PLAC9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLAC9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLAC9. This antibody reacts with human. The PLAC9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PLAC9(placenta-specific 9) The peptide sequence was selected from the middle region of PLAC9. Peptide sequence RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG. |
|---|
| Other Names | MGC104710, placenta-specific 9, placenta-specific protein 9 |
|---|
| Gene, Accession # | PLAC9, Gene ID: 219348, Accession: Q5JTB6, SwissProt: Q5JTB6 |
|---|
| Catalog # | NBP1-56571 |
|---|
| Price | |
|---|
| Order / More Info | PLAC9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|