| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | C1qTNF3/CORS26/CTRP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C1qTNF3/CORS26/CTRP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1qTNF3/CORS26/CTRP3. This antibody reacts with human. The C1qTNF3/CORS26/CTRP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C1qTNF3/CORS26/CTRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET |
|---|
| Other Names | C1ATNF3, C1q and tumor necrosis factor related protein 3, cartonectin, collagenous repeat-containing sequence of 26-kDa, complement C1q tumor necrosis factor-related protein 3, complement-c1q tumor necrosis factor-related protein 3, Corcs, Cors, Cors-26, CORS26, CTRP32310005P21Rik, FLJ37576, Secretory protein CORS26 |
|---|
| Gene, Accession # | C1QTNF3, Gene ID: 114899 |
|---|
| Catalog # | NBP2-49434 |
|---|
| Price | |
|---|
| Order / More Info | C1qTNF3/CORS26/CTRP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|