| 产品详情 |
| Edit |   |
| Antigenic Specificity | CPVL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CPVL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPVL. This antibody reacts with human. The CPVL Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CPVL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LYQIGLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVK |
| Other Names | carboxypeptidase, vitellogenic-likeVitellogenic carboxypeptidase-like protein, EC 3.4.16, EC 3.4.16.-, HVLP, MGC10029, probable serine carboxypeptidase CPVL, VCP-like protein, VLP |
| Gene, Accession # | CPVL, Gene ID: 54504, Accession: Q9H3G5, SwissProt: Q9H3G5 |
| Catalog # | NBP2-38792 |
| Price | |
| Order / More Info | CPVL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|