| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPT1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPT1C. This antibody reacts with human. The CPT1C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG |
|---|
| Other Names | carnitine O-palmitoyltransferase 1, brain isoform, Carnitine O-palmitoyltransferase I, brain isoform, carnitine palmitoyltransferase 1CCPT1-B, carnitine palmitoyltransferase I related C, CATL1, CPT IC, CPT1P, CPTI-B, CPTIC, EC 2.3.1.21, FLJ23809 |
|---|
| Gene, Accession # | CPT1C, Gene ID: 126129 |
|---|
| Catalog # | NBP2-68811 |
|---|
| Price | |
|---|
| Order / More Info | CPT1C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|