| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPT1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPT1B. This antibody reacts with human, mouse. The CPT1B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA. |
|---|
| Other Names | carnitine O-palmitoyltransferase 1, muscle isoform, carnitine O-palmitoyltransferase I, mitochondrial muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase 1B, carnitine palmitoyltransferase 1B (muscle), Carnitine palmitoyltransferase I-like protein, CPT I, CPT1M, CPT1-MMCCPT1, CPTI, CPTI-M, EC 2.3.1, EC 2.3.1.21, FLJ55729, FLJ58750, KIAA1670, MCPT1, M-CPT1 |
|---|
| Gene, Accession # | CPT1B, Gene ID: 1375, Accession: Q92523, SwissProt: Q92523 |
|---|
| Catalog # | NBP1-59576-100ul |
|---|
| Price | |
|---|
| Order / More Info | CPT1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27006481, 28926107 |
|---|
| 产品资料 |
|
|