| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPT1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPT1A. This antibody reacts with human. The CPT1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to CPT1A(carnitine palmitoyltransferase 1A (liver)) The peptide sequence was selected from the middle region of CPT1A (NP_001027017). Peptide sequence LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN. |
|---|
| Other Names | carnitine O-palmitoyltransferase 1, liver isoform, Carnitine O-palmitoyltransferase I, liver isoform, Carnitine palmitoyltransferase 1A, carnitine palmitoyltransferase 1A (liver), carnitine palmitoyltransferase I, liver, CPT I, CPT1, CPT1-LEC 2.3.1.21, CPTI-L, EC 2.3.1, L-CPT1 |
|---|
| Gene, Accession # | CPT1A, Gene ID: 1374, Accession: P50416, SwissProt: P50416 |
|---|
| Catalog # | NBP1-59608 |
|---|
| Price | |
|---|
| Order / More Info | CPT1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|