| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRIB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIB3. This antibody reacts with human. The TRIB3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRIB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
|---|
| Other Names | C20orf97, dJ1103G7.3, neuronal cell death inducible putative kinase, Neuronal cell death-inducible putative kinase, NIPK, p65-interacting inhibitor of NF-kappaB, p65-interacting inhibitor of NF-kappa-B, SINK, SKIP3, TRB-3, TRB3chromosome 20 open reading frame 97, tribbles homolog 3, tribbles homolog 3 (Drosophila) |
|---|
| Gene, Accession # | TRIB3, Gene ID: 57761 |
|---|
| Catalog # | NBP2-56109 |
|---|
| Price | |
|---|
| Order / More Info | TRIB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|