| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRIB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIB1. This antibody reacts with human. The TRIB1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to TRIB1(tribbles homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of TRIB1 (NP_079471). Peptide sequence TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA. |
|---|
| Other Names | C8FWG-protein-coupled receptor induced protein, GIG-2, GIG2G-protein-coupled receptor-induced protein 2, G-protein-coupled receptor-induced gene 2 protein, SKIP1, TRB-1, TRB1phosphoprotein regulated by mitogenic pathways, tribbles homolog 1, tribbles homolog 1 (Drosophila), tribbles-like protein 1 |
|---|
| Gene, Accession # | TRIB1, Gene ID: 10221, Accession: Q96RU8, SwissProt: Q96RU8 |
|---|
| Catalog # | NBP1-55386 |
|---|
| Price | |
|---|
| Order / More Info | TRIB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|