| 产品详情 |
| Edit |   |
| Antigenic Specificity | SRC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRC1. This antibody reacts with human. The SRC1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SRC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL |
| Other Names | bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74, EC 2.3.1.48, Hin-2 protein, KAT13A, MGC129719, NCoA-1, nuclear receptor coactivator 1, PAX3/NCOA1 fusion protein, Protein Hin-2, Renal carcinoma antigen NY-REN-52, RIP160bHLHe74F-SRC-1, SRC-1, SRC1MGC129720, Steroid receptor coactivator 1, steroid receptor coactivator-1 |
| Gene, Accession # | NCOA1, Gene ID: 8648 |
| Catalog # | NBP2-57610 |
| Price | |
| Order / More Info | SRC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|