| 产品详情 |
| Edit |   |
| Antigenic Specificity | Src |
| Clone | 1B9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Src Antibody (1B9) from Novus Biologicals is a mouse monoclonal antibody to Src. This antibody reacts with human. The Src Antibody (1B9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay. |
| Immunogen | SRC (AAH11566, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV |
| Other Names | c-src, EC 2.7.10, EC 2.7.10.2, pp60c-src, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
| Gene, Accession # | SRC, Gene ID: 6714, Accession: AAH11566, SwissProt: AAH11566 |
| Catalog # | H00006714-M01 |
| Price | |
| Order / More Info | Src Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|