| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Src |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Src Antibody from Novus Biologicals is a rabbit polyclonal antibody to Src. This antibody reacts with human. The Src Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Src antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
|---|
| Other Names | c-src, EC 2.7.10, EC 2.7.10.2, pp60c-src, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
|---|
| Gene, Accession # | SRC, Gene ID: 6714, Accession: P12931, SwissProt: P12931 |
|---|
| Catalog # | NBP2-38165 |
|---|
| Price | |
|---|
| Order / More Info | Src Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|