| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD27/TNFRSF7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD27/TNFRSF7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD27/TNFRSF7. This antibody reacts with human. The CD27/TNFRSF7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD27/TNFRSF7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
|---|
| Other Names | CD27 antigen, CD27 molecule, MGC20393, S152CD27L receptor, T cell activation antigen CD27, T cell activation antigen S152, T14, TNFRSF7T-cell activation antigen CD27, Tp55, Tumor necrosis factor receptor superfamily member 7, tumor necrosis factor receptor superfamily, member 7 |
|---|
| Gene, Accession # | CD27, Gene ID: 939, Accession: P26842, SwissProt: P26842 |
|---|
| Catalog # | NBP2-38434 |
|---|
| Price | |
|---|
| Order / More Info | CD27/TNFRSF7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|